Mouse Anti-GFOD2 Antibody (CBMOAB-43533FYA)


Cat: CBMOAB-43533FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43533FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43533FYA 100 µg
CBMOAB-77797FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77797FYA 100 µg
MO-AB-12980R Monoclonal Cattle (Bos taurus) WB, ELISA MO12980R 100 µg
MO-AB-19304W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19304W 100 µg
MO-AB-55959W Monoclonal Marmoset WB, ELISA MO55959W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO43533FYA
SpecificityThis antibody binds to Rhesus GFOD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GFOD2 Antibody is a mouse antibody against GFOD2. It can be used for GFOD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGFOD2
UniProt IDF6XRG0
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: MVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry