AibGenesis™ Mouse Anti-GGT7 Antibody (CBMOAB-43572FYA)


Cat: CBMOAB-43572FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43572FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO43572FYA 100 µg
MO-AB-10574W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10574W 100 µg
MO-AB-12999R Monoclonal Cattle (Bos taurus) WB, ELISA MO12999R 100 µg
MO-AB-55983W Monoclonal Marmoset WB, ELISA MO55983W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO43572FYA
SpecificityThis antibody binds to Rhesus GGT7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. The protein encoded by this gene consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis. (From NCBI)
Product OverviewMouse Anti-Rhesus GGT7 Antibody is a mouse antibody against GGT7. It can be used for GGT7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGGT7
UniProt IDF7ERS3
Protein RefseqThe length of the protein is 608 amino acids long.
The sequence is show below: MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDSFLKSARLQRLPSSSSEMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATGVTVALVMQIYFGDPQIFQQGAVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHVIDFRESAPGALREETLQRSWETKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALAEQLPPNMSERFRETFLPSGRPPLPGSLLQRPDLAEVLDVLGTSGPAAFYAGSNLTLEMVAEAQHAGGVITEEDFSNYSALVEKPVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPIYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAVGLCGTYLALGANGAARGLSGLTQHLNRQPGLFRVFERKGLLLCRTSQNGSLNVLRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry