AibGenesis™ Mouse Anti-GJC3 Antibody (CBMOAB-43622FYA)


Cat: CBMOAB-43622FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43622FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset WB, ELISA MO43622FYA 100 µg
MO-AB-00544L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00544L 100 µg
MO-AB-08151W Monoclonal Cat (Felis catus) WB, ELISA MO08151W 100 µg
MO-AB-13088R Monoclonal Cattle (Bos taurus) WB, ELISA MO13088R 100 µg
MO-AB-14502W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14502W 100 µg
MO-AB-30948W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30948W 100 µg
MO-AB-41730W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41730W 100 µg
MO-AB-44882W Monoclonal Horse (Equus caballus) WB, ELISA MO44882W 100 µg
MO-AB-56040W Monoclonal Marmoset WB, ELISA MO56040W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset
CloneMO43622FYA
SpecificityThis antibody binds to Rhesus GJC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a gap junction protein. The encoded protein, also known as a connexin, plays a role in formation of gap junctions, which provide direct connections between neighboring cells. Mutations in this gene have been reported to be associated with nonsyndromic hearing loss. (From NCBI)
Product OverviewMouse Anti-Rhesus GJC3 Antibody is a mouse antibody against GJC3. It can be used for GJC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGJC3
UniProt IDF6YWV6
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: HTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGGEGNTDVPGAGSLRLLWAYVAQLGARLVLEGTALGLQYHLYGFQMPSSFACRREPCLGSITCHLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKPSSSKYFPTSESTRRHKEATDSLPVVETKEQFQEAVPGRSSAQEKQRPVGPRDA.
For Research Use Only | Not For Clinical Use.
Online Inquiry