AibGenesis™ Mouse Anti-GLIPR1L2 Antibody (CBMOAB-43663FYA)


Cat: CBMOAB-43663FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43663FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO43663FYA 100 µg
Inquiry
MO-AB-26023H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26023C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO43663FYA
SpecificityThis antibody binds to Rhesus GLIPR1L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus GLIPR1L2 Antibody is a mouse antibody against GLIPR1L2. It can be used for GLIPR1L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGLIPR1L2
UniProt IDF7DRF4
Protein RefseqThe length of the protein is 312 amino acids long.
The sequence is show below: MEAPRSFAREWSAQSLPLAVGGVLKLRLCELWLLLLGSSLNATFLPHEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKRCVFEHNIYLEDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYVQLVWDNSYKVGCAVTPCSRIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRHDKCTDFLCSNADRDQAIYYRFWYPKWEMPRPILCDPLCTFILLLRIICFMLCVITVLIVQSQFPNILLEQQMIFTPEESEAENEEEEKQKEKKEKEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry