Mouse Anti-GLUR2 Antibody (CBMOAB-43714FYA)


Cat: CBMOAB-43714FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43714FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Guinea pig (Cavia porcellus) WB, ELISA MO43714FYA 100 µg
MO-AB-02142Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02142Y 100 µg
MO-AB-41739W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41739W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Guinea pig (Cavia porcellus)
CloneMO43714FYA
SpecificityThis antibody binds to Rhesus GLUR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GLUR2 Antibody is a mouse antibody against GLUR2. It can be used for GLUR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutamate receptor subunit 2; GLUR2
UniProt IDQ646U1
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: VARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMXVALIEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry