Mouse Anti-GNA11 Antibody (CBMOAB-43750FYA)
Cat: CBMOAB-43750FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-43750FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Frog (Xenopus), Marmoset, O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO43750FYA | 100 µg | ||
MO-AB-02160Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02160Y | 100 µg | ||
MO-AB-03947H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03947C | 100 µg | ||
MO-AB-11518Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11518Y | 100 µg | ||
MO-AB-13154R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13154R | 100 µg | ||
MO-AB-25427W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25427W | 100 µg | ||
MO-AB-26130R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26130R | 100 µg | ||
MO-AB-30968W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30968W | 100 µg | ||
MO-AB-37346W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37346W | 100 µg | ||
MO-AB-43181W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43181W | 100 µg | ||
MO-AB-56105W | Monoclonal | Marmoset | WB, ELISA | MO56105W | 100 µg | ||
MO-DKB-01297W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Frog (Xenopus), Marmoset, O. mykiss (Oncorhynchus mykiss) |
Clone | MO43750FYA |
Specificity | This antibody binds to Rhesus GNA11. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. (From NCBI) |
Product Overview | Mouse Anti-Rhesus GNA11 Antibody is a mouse antibody against GNA11. It can be used for GNA11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GNA11 |
UniProt ID | F7HQU9 |
Protein Refseq | The length of the protein is 170 amino acids long. The sequence is show below: RMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPKQDAEAAKRFILDMYTRMYTGCVDGPDGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLARYLDEINLL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry