Mouse Anti-GPR114 Antibody (CBMOAB-43912FYA)


Cat: CBMOAB-43912FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43912FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO43912FYA 100 µg
MO-AB-13274R Monoclonal Cattle (Bos taurus) WB, ELISA MO13274R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO43912FYA
SpecificityThis antibody binds to Rhesus GPR114.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPR114 Antibody is a mouse antibody against GPR114. It can be used for GPR114 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPR114
UniProt IDF7H253
Protein RefseqThe length of the protein is 527 amino acids long.
The sequence is show below: MDHCGTLFLCLCLLTLQNATAETWKELLSYMENMQVSRARSPFFYLRQLHQLEQMLLNTSFPGYNLTLQTPAIQSLAFKLSCNFSGLSLSSATLKRVPQHARGQYAWGQHAMQFPAELTQDACKTRPGELRLICIYFSNAHFFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLHHHHLLHLHHHHHHLLHLYHHHLLYLLHLYHHHHLLHLYHHHHLLHLLHLCHHHHHLLTSTITIITYISSISIITIISSTSITTIISSTSFTTVTTSSTSITTIITSSTFSISNSTITATFITVLAPFLLISISSEVPHWGLRTVSSQLSLAQWNSVSAAPGTKGQPSPTSPEPLSHLSGVPALLVLLCLSVKSSVYGPHTIPVFNSWENGTGFQNMSMCWVRSPVVHSVLVMGYGGLTSLFNLVVLAWALWTLRRLRVRADAPNARACHDTVTVLGLTVLLGTTWALAFFSFGIFLLPQLFLFTILNSLYGFFLFLWFCSQRCRSEAEAKAQVEAFSSSQTTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry