AibGenesis™ Mouse Anti-GPR141 Antibody (CBMOAB-43940FYA)


Cat: CBMOAB-43940FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43940FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO43940FYA 100 µg
MO-AB-26091H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26091C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO43940FYA
SpecificityThis antibody binds to Rhesus GPR141.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPR141 Antibody is a mouse antibody against GPR141. It can be used for GPR141 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPR141
UniProt IDF6S4M8
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MPGHNTSRNSSCDPLVTSHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYFIKETWIFGLPFCRFVSAMLHIHMYLTFLFYVVILVTRYLIFFKRKDKVEFYRKLHAVAASAGLWTLVIVIVVPLVVSRYGIHEEYNEKDCFKFHKELAYTYVKVINYMIVIFVIAIAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNTCNSKIAFYNEIFLSVTAISCCDLLLFVFGGSHWFKQKIIDLWNCVLCR.
For Research Use Only | Not For Clinical Use.
Online Inquiry