AibGenesis™ Mouse Anti-GPR144 Antibody (CBMOAB-43945FYA)


Cat: CBMOAB-43945FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43945FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO43945FYA 100 µg
CBMOAB-78461FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78461FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO43945FYA
SpecificityThis antibody binds to Rhesus GPR144.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPR144 Antibody is a mouse antibody against GPR144. It can be used for GPR144 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative G-protein coupled receptor 144; GPR144
UniProt IDH9FEU0
Protein RefseqThe length of the protein is 78 amino acids long.
The sequence is show below: AGVPKSERTTVHKNLTFSLACAEGFLMTSEWAKANEVACVAVTVAMHFLFLAAFSWMLVEGLLLWRKVVAVSMHPGPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry