Mouse Anti-GPR34 Antibody (CBMOAB-44013FYA)


Cat: CBMOAB-44013FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44013FYA Monoclonal Rhesus (Macaca mulatta), Guinea pig (Cavia porcellus), Marmoset WB, ELISA MO44013FYA 100 µg
MO-AB-41765W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41765W 100 µg
MO-AB-56286W Monoclonal Marmoset WB, ELISA MO56286W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Guinea pig (Cavia porcellus), Marmoset
CloneMO44013FYA
SpecificityThis antibody binds to Rhesus GPR34.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPR34 Antibody is a mouse antibody against GPR34. It can be used for GPR34 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPR34
UniProt IDF7BKR6
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MRSHTITMTTTSVSSWPYSSHRMRFITSHSDQPPQNFSGTPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVVIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNIIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAAKIHSSSKST.
For Research Use Only | Not For Clinical Use.
Online Inquiry