AibGenesis™ Mouse Anti-GPR39 Antibody (CBMOAB-44015FYA)


Cat: CBMOAB-44015FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44015FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO44015FYA 100 µg
CBMOAB-78516FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78516FYA 100 µg
MO-AB-02209Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02209Y 100 µg
MO-AB-13299R Monoclonal Cattle (Bos taurus) WB, ELISA MO13299R 100 µg
MO-AB-13743W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13743W 100 µg
MO-AB-26204R Monoclonal Pig (Sus scrofa) WB, ELISA MO26204R 100 µg
MO-AB-56290W Monoclonal Marmoset WB, ELISA MO56290W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO44015FYA
SpecificityThis antibody binds to Rhesus GPR39.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the ghrelin receptor family and encodes a rhodopsin-type G-protein-coupled receptor (GPCR). The encoded protein is involved in zinc-dependent signaling in epithelial tissue in intestines, prostate and salivary glands. The protein may also be involved in the pathophysiology of depression. (From NCBI)
Product OverviewMouse Anti-Rhesus GPR39 Antibody is a mouse antibody against GPR39. It can be used for GPR39 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPR39
UniProt IDH9H3U7
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: MASPSSPGSDCSHVIDHSHVPEFEVATWIKVTLILVYLVIFVMGLLGNSVTIRVTQVLQKKGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTPSYTLSCKLHTFLFEACSYATLLHVLTLSFERYIAICHPFRYKAVSGPCQVKLLIGFVWVTSALVALPLLFAMGTEYPLVKVPNHWGLTCNRSRTRHHEQPETSNMSICTNLSSRWTVFQSSIFGAFVVYLVVLLSVAFMCWNMMQVLMKSQKGTLAGDAQPPQLRKSESEESRTARRQTIIFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry