Mouse Anti-GPR50 Antibody (CBMOAB-44021FYA)


Cat: CBMOAB-44021FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44021FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO44021FYA 100 µg
MO-AB-03738W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03738W 100 µg
MO-AB-15580Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15580Y 100 µg
MO-AB-26095H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26095C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO44021FYA
SpecificityThis antibody binds to Rhesus GPR50.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Plasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPR50 Antibody is a mouse antibody against GPR50. It can be used for GPR50 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPR50
UniProt IDF7GTE4
Protein RefseqThe length of the protein is 628 amino acids long.
The sequence is show below: MGPTLAVPTPYGCIGCKLPHPDYPPALIIFMFCAMVITIVVDLISNSMVILAVTKSKKLRNSGNIFVVSLSVADMLVAIYPYPLMLHAMSTGGWDLSQLQCQMVGFITGLSVVSSIFNIVAIAINRYCYICHSLQYERIFSARNTCIYLVVTWIMTILAVLPNMYIGTIEYDPRTYTCIFNYLNNPVFTVTIVCIHFVLPLLIVGFCYLRIWTKVLAARDPAGQNPDNQLAEVRNFLTMFVIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNENFRREYWTIFHAMRHPIIFFSGLISDIREMQEAHALARARAHARDQACEQALEQDCAHACPAVEETLMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKPVSGHSKPASGHPKSATVYPKPASVYFKADSVHFKPASVHFKGDSVHFKPDSVHFKPASSHPKPITGHHVSTGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPEPTAADHPELSASHCPEIPAIAHPESDDSDLPASASSPASGPTKPAASQLEPDTIADLPDTTVVTTNTHDYHDVVVIDVEDDLNEMAV.
For Research Use Only | Not For Clinical Use.
Online Inquiry