Mouse Anti-GPR61 Antibody (CBMOAB-44027FYA)
Cat: CBMOAB-44027FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44027FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO44027FYA | 100 µg | ||
CBMOAB-78523FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78523FYA | 100 µg | ||
MO-AB-13307R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13307R | 100 µg | ||
MO-AB-56295W | Monoclonal | Marmoset | WB, ELISA | MO56295W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) |
Clone | MO44027FYA |
Specificity | This antibody binds to Rhesus GPR61. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus GPR61 Antibody is a mouse antibody against GPR61. It can be used for GPR61 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative G-protein coupled receptor 61; GPR61 |
UniProt ID | H9F3S2 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: EENFLQFLQGTGCASESWVSRPLPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAPSPRLES. |
For Research Use Only | Not For Clinical Use.
Online Inquiry