Mouse Anti-GSDMA Antibody (CBMOAB-44171FYA)


Cat: CBMOAB-44171FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44171FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO44171FYA 100 µg
MO-AB-13380R Monoclonal Cattle (Bos taurus) WB, ELISA MO13380R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO44171FYA
SpecificityThis antibody binds to Rhesus GSDMA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GSDMA Antibody is a mouse antibody against GSDMA. It can be used for GSDMA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGSDMA
UniProt IDF6UG95
Protein RefseqThe length of the protein is 445 amino acids long.
The sequence is show below: MTMFENVTRALVRQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFLKEMQDQGENLYVVMEVVETVREVTLERAGKAEACFSLPFFAPLGLQGSINHKEAIAIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVIRARWRAVWDVHEGFGTLKEEVQRETQQVERLSQAGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEVQQKLLVKSMEKKILPVQLKLVESTMEQNFLQDKEGVFPLHPELLSSLGEEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry