AibGenesis™ Mouse Anti-GTDC1 Antibody (CBMOAB-44226FYA)


Cat: CBMOAB-44226FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44226FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO44226FYA 100 µg
CBMOAB-60168FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60168FYC 100 µg
CBMOAB-78864FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78864FYA 100 µg
MO-AB-02242Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02242Y 100 µg
MO-AB-13416R Monoclonal Cattle (Bos taurus) WB, ELISA MO13416R 100 µg
MO-AB-23967W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23967W 100 µg
MO-AB-56475W Monoclonal Marmoset WB, ELISA MO56475W 100 µg
MO-DKB-01553W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO44226FYA
SpecificityThis antibody binds to Rhesus GTDC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GTDC1 Antibody is a mouse antibody against GTDC1. It can be used for GTDC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTDC1
UniProt IDF7HKU7
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MSILIIEAFYGGSHKQLVDLLQEELGDCVLYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNLTELAALRPDLGKLKTILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSIGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLSLKGNGGTVLSMALPFQPEQRDSEGLLKNSNSECDAHCGLDTARREYLGNSLRQESDLKKSTSPENSSSHRGENKQNLTVNPCATLGGDANQQRLLHIVWPHRWEHDKDPESFFKVLMHLKDLGLNFHVSILGETFTDVPGWKLCTVGVTHFVLKIWFIPKYFQLNICILHLNSFQKGSRISARDQIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry