AibGenesis™ Mouse Anti-GTF3C6 Antibody (CBMOAB-44251FYA)


Cat: CBMOAB-44251FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44251FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO44251FYA 100 µg
CBMOAB-78916FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78916FYA 100 µg
MO-AB-04112H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04112C 100 µg
MO-AB-10287W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10287W 100 µg
MO-AB-26181H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26181C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO44251FYA
SpecificityThis antibody binds to Rhesus GTF3C6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GTF3C6 Antibody is a mouse antibody against GTF3C6. It can be used for GTF3C6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTF3C6
UniProt IDF6XM63
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: MAAADERGMEDGEEEEEEEQLVLVELSGIIDSDFLSKCQNKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICSFLHENEDEEVAASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLDIEDSGPLIDIPSETEGSVFMETQMLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry