AibGenesis™ Mouse Anti-GTSF1L Antibody (CBMOAB-44274FYA)


Cat: CBMOAB-44274FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44274FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO44274FYA 100 µg
MO-AB-13443R Monoclonal Cattle (Bos taurus) WB, ELISA MO13443R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO44274FYA
SpecificityThis antibody binds to Rhesus GTSF1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GTSF1L Antibody is a mouse antibody against GTSF1L. It can be used for GTSF1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTSF1L
UniProt IDF7AQG0
Protein RefseqThe length of the protein is 123 amino acids long.
The sequence is show below: MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMAICKYNACHVVPIKKLEEHEAVCVNRSSVEEEDTENPLKVSLPSSEQNGDPQQTFVPQKLVCENDTKESAREISPQKILRPGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry