AibGenesis™ Mouse Anti-H2AFV Antibody (CBMOAB-44311FYA)
Cat: CBMOAB-44311FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44311FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO44311FYA | 100 µg | ||
| CBMOAB-79000FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79000FYA | 100 µg | ||
| MO-AB-00598L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00598L | 100 µg | ||
| MO-AB-06543Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06543Y | 100 µg | ||
| MO-AB-07311W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07311W | 100 µg | ||
| MO-AB-08285Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08285Y | 100 µg | ||
| MO-AB-12084W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12084W | 100 µg | ||
| MO-AB-23274H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23274C | 100 µg | ||
| MO-AB-26214H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26214C | 100 µg | ||
| MO-AB-26279R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26279R | 100 µg | ||
| MO-AB-34870W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34870W | 100 µg | ||
| MO-AB-41789W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41789W | 100 µg | ||
| MO-AB-56542W | Monoclonal | Marmoset | WB, ELISA | MO56542W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Mallard (Anas platyrhynchos), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO44311FYA |
| Specificity | This antibody binds to Rhesus H2AFV. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus H2AFV Antibody is a mouse antibody against H2AFV. It can be used for H2AFV detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Histone H2A; H2AFV |
| UniProt ID | H9EMP8 |
| Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: MAGGKAGKDSGKAKAKAVSRSQRAGLQVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry