AibGenesis™ Mouse Anti-HAPLN3 Antibody (CBMOAB-44347FYA)
Cat: CBMOAB-44347FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44347FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO44347FYA | 100 µg | ||
| CBMOAB-79070FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79070FYA | 100 µg | ||
| MO-AB-04163H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04163C | 100 µg | ||
| MO-AB-13528R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13528R | 100 µg | ||
| MO-AB-17923W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17923W | 100 µg | ||
| MO-AB-56575W | Monoclonal | Marmoset | WB, ELISA | MO56575W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO44347FYA |
| Specificity | This antibody binds to Rhesus HAPLN3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene belongs to the hyaluronan and proteoglycan binding link protein gene family. The protein encoded by this gene may function in hyaluronic acid binding and cell adhesion. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus HAPLN3 Antibody is a mouse antibody against HAPLN3. It can be used for HAPLN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Hyaluronan and proteoglycan link protein 3; HAPLN3 |
| UniProt ID | H9F4G1 |
| Protein Refseq | The length of the protein is 49 amino acids long. The sequence is show below: DAGWLADGSGRYPVVHPHPNCGPPEPGVRSFGFPDPQSRLYGVYCYRQH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry