AibGenesis™ Mouse Anti-HDDC2 Antibody (CBMOAB-44413FYA)


Cat: CBMOAB-44413FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44413FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO44413FYA 100 µg
CBMOAB-79213FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79213FYA 100 µg
MO-AB-13603R Monoclonal Cattle (Bos taurus) WB, ELISA MO13603R 100 µg
MO-AB-13906W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13906W 100 µg
MO-AB-26261H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26261C 100 µg
MO-AB-56633W Monoclonal Marmoset WB, ELISA MO56633W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO44413FYA
SpecificityThis antibody binds to Rhesus HDDC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HDDC2 Antibody is a mouse antibody against HDDC2. It can be used for HDDC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHDDC2
UniProt IDF7FMD5
Protein RefseqThe length of the protein is 171 amino acids long.
The sequence is show below: MASVSSATFLGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRPEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGSLQDFYDSTAGKFNHPEIVQLVSELEAERNANIAAAASEPHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry