AibGenesis™ Mouse Anti-HEXDC Antibody (CBMOAB-44502FYA)


Cat: CBMOAB-44502FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44502FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO44502FYA 100 µg
CBMOAB-79388FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79388FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO44502FYA
SpecificityThis antibody binds to Rhesus HEXDC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HEXDC Antibody is a mouse antibody against HEXDC. It can be used for HEXDC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHEXDC
UniProt IDF6TUW6
Protein RefseqThe length of the protein is 540 amino acids long.
The sequence is show below: MSGSTPFKMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRAKYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHAAFAHLREVGPFPCTLNPHEAESLALVGAMIDQVLELHPGARWLHVGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRAVASHVQTQRPSVTPLVWDDMLRDLPEDQLAASGVPQLVEPVLWDYAADLDVHGKVLLMQKYWRCGFPRLWAASAFKGATGPSQAVPPIRHHLRNHVQWLQVAGSRPTDSLQGIILTGWQRYDHFSVLCELLPAGVPSLAACLQLLLHGGFDGDAKAKVENLLGISNLEMMDPGSLQGGGRLFPWQQHPCPCHTSQPPSAQLCGRAAGGQHVRHRLVQPLPPPAEAHPPGHGSAHPARSTQPPGAVEHPRAGAGGRPAAGFLPGCRGGVAGGERAPQPAAAASSTAGPQRGGHPLTPTPTPTPTHQPWQGHCSGPLRGELVPGGSCYGQGGSALPTVSQGNRGPRDCCTLWPSSVWPTLSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry