Mouse Anti-HMG20A Antibody (CBMOAB-44641FYA)
Cat: CBMOAB-44641FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44641FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO44641FYA | 100 µg | ||
| CBMOAB-79573FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79573FYA | 100 µg | ||
| MO-AB-13696R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13696R | 100 µg | ||
| MO-AB-16399W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16399W | 100 µg | ||
| MO-AB-45036W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45036W | 100 µg | ||
| MO-AB-56818W | Monoclonal | Marmoset | WB, ELISA | MO56818W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO44641FYA |
| Specificity | This antibody binds to Rhesus HMG20A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus HMG20A Antibody is a mouse antibody against HMG20A. It can be used for HMG20A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | HMG20A; HMG20A |
| UniProt ID | A2D665 |
| Protein Refseq | The length of the protein is 44 amino acids long. The sequence is show below: SGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry