AibGenesis™ Mouse Anti-HRASLS Antibody (CBMOAB-44813FYA)


Cat: CBMOAB-44813FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44813FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO44813FYA 100 µg
CBMOAB-79945FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79945FYA 100 µg
MO-AB-13801R Monoclonal Cattle (Bos taurus) WB, ELISA MO13801R 100 µg
MO-AB-56953W Monoclonal Marmoset WB, ELISA MO56953W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO44813FYA
SpecificityThis antibody binds to Rhesus HRASLS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HRASLS Antibody is a mouse antibody against HRASLS. It can be used for HRASLS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHRAS-like suppressor; HRASLS
UniProt IDI2CT98
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPVSFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSQQANRAISTVGFVTAAVGAFSFLGLFPKGQRTKYY.
For Research Use Only | Not For Clinical Use.
Online Inquiry