Mouse Anti-HS2ST1 Antibody (CBMOAB-44824FYA)


Cat: CBMOAB-44824FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44824FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO44824FYA 100 µg
MO-AB-04362H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04362C 100 µg
MO-AB-17931W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17931W 100 µg
MO-AB-26377H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26377C 100 µg
MO-AB-56963W Monoclonal Marmoset WB, ELISA MO56963W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO44824FYA
SpecificityThis antibody binds to Rhesus HS2ST1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHeparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus HS2ST1 Antibody is a mouse antibody against HS2ST1. It can be used for HS2ST1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHS2ST1
UniProt IDF7HU07
Protein RefseqThe length of the protein is 288 amino acids long.
The sequence is show below: ERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLVNEYFLVGVTEELEDFIMLLEAALPRFFRGATELYRTAPDTATPSHWHGPICGSKSISSLLVKVSTVCKDSHCLGKCSRNGLSAV.
For Research Use Only | Not For Clinical Use.
Online Inquiry