AibGenesis™ Mouse Anti-IGFBPL1 Antibody (CBMOAB-45143FYA)


Cat: CBMOAB-45143FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45143FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO45143FYA 100 µg
MO-AB-14066R Monoclonal Cattle (Bos taurus) WB, ELISA MO14066R 100 µg
MO-AB-57169W Monoclonal Marmoset WB, ELISA MO57169W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO45143FYA
SpecificityThis antibody binds to Rhesus IGFBPL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus IGFBPL1 Antibody is a mouse antibody against IGFBPL1. It can be used for IGFBPL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInsulin-like growth factor-binding protein-like 1; IGFBPL1
UniProt IDH9F4F3
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: PTPVITWRKVMQSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFRFPAPDDRM.
For Research Use Only | Not For Clinical Use.
Online Inquiry