Mouse Anti-INCA1 Antibody (MO-AB-03789W)


Cat: MO-AB-03789W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03789W Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO03789W 100 µg
MO-AB-26536H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26536C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO03789W
SpecificityThis antibody binds to Rhesus INCA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus INCA1 Antibody is a mouse antibody against INCA1. It can be used for INCA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein INCA1 isoform 2; INCA1
UniProt IDH9FH68
Protein RefseqThe length of the protein is 82 amino acids long.
The sequence is show below: LWRRKKRRPCLERMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry