AibGenesis™ Mouse Anti-INPP1 Antibody (CBMOAB-45423FYA)


Cat: CBMOAB-45423FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45423FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO45423FYA 100 µg
MO-AB-03803W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03803W 100 µg
MO-AB-04516H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04516C 100 µg
MO-AB-14202R Monoclonal Cattle (Bos taurus) WB, ELISA MO14202R 100 µg
MO-AB-23380W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23380W 100 µg
MO-AB-57282W Monoclonal Marmoset WB, ELISA MO57282W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO45423FYA
SpecificityThis antibody binds to Rhesus INPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. (From NCBI)
Product OverviewMouse Anti-Rhesus INPP1 Antibody is a mouse antibody against INPP1. It can be used for INPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInositol polyphosphate 1-phosphatase; INPP1
UniProt IDI2CU12
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEEEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKHIFGEESNEFTNDLGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRSGSEIHAGNTGSEAAFSPSFSAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHMENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLASAETQT.
For Research Use Only | Not For Clinical Use.
Online Inquiry