Mouse Anti-INSIG1 Antibody (CBMOAB-45455FYA)
Cat: CBMOAB-45455FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45455FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Goat (Capra hircus), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO45455FYA | 100 µg | ||
| CBMOAB-80945FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80945FYA | 100 µg | ||
| MO-AB-00669L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00669L | 100 µg | ||
| MO-AB-00766R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00766R | 100 µg | ||
| MO-AB-06581Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06581Y | 100 µg | ||
| MO-AB-07367W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07367W | 100 µg | ||
| MO-AB-08506Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08506Y | 100 µg | ||
| MO-AB-14207R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14207R | 100 µg | ||
| MO-AB-15818Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15818Y | 100 µg | ||
| MO-AB-21800W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21800W | 100 µg | ||
| MO-AB-23327H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23327C | 100 µg | ||
| MO-AB-26702R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26702R | 100 µg | ||
| MO-AB-31316W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31316W | 100 µg | ||
| MO-AB-33323H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33323C | 100 µg | ||
| MO-AB-37514W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37514W | 100 µg | ||
| MO-AB-41887W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41887W | 100 µg | ||
| MO-AB-43211W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43211W | 100 µg | ||
| MO-AB-45178W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45178W | 100 µg | ||
| MO-AB-57304W | Monoclonal | Marmoset | WB, ELISA | MO57304W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Goat (Capra hircus), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO45455FYA |
| Specificity | This antibody binds to Rhesus INSIG1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an endoplasmic reticulum membrane protein that regulates cholesterol metabolism, lipogenesis, and glucose homeostasis. The encoded protein has six transmembrane helices which contain an effector protein binding site. It binds the sterol-sensing domains of sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase), and is essential for the sterol-mediated trafficking of these two proteins. It promotes the endoplasmic reticulum retention of SCAP and the ubiquitin-mediated degradation of HMG-CoA reductase. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus INSIG1 Antibody is a mouse antibody against INSIG1. It can be used for INSIG1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Insulin-induced gene protein; INSIG1 |
| UniProt ID | F7H2V2 |
| Protein Refseq | The length of the protein is 192 amino acids long. The sequence is show below: AVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMLIPCEELNLKATWLFHKNRSNYKVFLKSPIVIESSKPPVLRARKILEENLIVDYDKDYLFS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry