AibGenesis™ Mouse Anti-INSIG2 Antibody (CBMOAB-45458FYA)
Cat: CBMOAB-45458FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45458FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO45458FYA | 100 µg | ||
| CBMOAB-80946FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80946FYA | 100 µg | ||
| MO-AB-00670L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00670L | 100 µg | ||
| MO-AB-07872W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07872W | 100 µg | ||
| MO-AB-08507Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08507Y | 100 µg | ||
| MO-AB-11661W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11661W | 100 µg | ||
| MO-AB-14214R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14214R | 100 µg | ||
| MO-AB-15819Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15819Y | 100 µg | ||
| MO-AB-23328H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23328C | 100 µg | ||
| MO-AB-26548H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26548C | 100 µg | ||
| MO-AB-31317W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31317W | 100 µg | ||
| MO-AB-34986W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34986W | 100 µg | ||
| MO-AB-37515W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37515W | 100 µg | ||
| MO-AB-45179W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45179W | 100 µg | ||
| MO-AB-57305W | Monoclonal | Marmoset | WB, ELISA | MO57305W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO45458FYA |
| Specificity | This antibody binds to Rhesus INSIG2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus INSIG2 Antibody is a mouse antibody against INSIG2. It can be used for INSIG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Insulin-induced gene protein; INSIG2 |
| UniProt ID | F7HBW4 |
| Protein Refseq | The length of the protein is 237 amino acids long. The sequence is show below: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIANLIRNEEGKTYLLYKKTR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry