AibGenesis™ Mouse Anti-INSIG2 Antibody (CBMOAB-45458FYA)


Cat: CBMOAB-45458FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45458FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO45458FYA 100 µg
CBMOAB-80946FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80946FYA 100 µg
MO-AB-00670L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00670L 100 µg
MO-AB-07872W Monoclonal Cat (Felis catus) WB, ELISA MO07872W 100 µg
MO-AB-08507Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08507Y 100 µg
MO-AB-11661W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11661W 100 µg
MO-AB-14214R Monoclonal Cattle (Bos taurus) WB, ELISA MO14214R 100 µg
MO-AB-15819Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15819Y 100 µg
MO-AB-23328H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23328C 100 µg
MO-AB-26548H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26548C 100 µg
MO-AB-31317W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31317W 100 µg
MO-AB-34986W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34986W 100 µg
MO-AB-37515W Monoclonal Goat (Capra hircus) WB, ELISA MO37515W 100 µg
MO-AB-45179W Monoclonal Horse (Equus caballus) WB, ELISA MO45179W 100 µg
MO-AB-57305W Monoclonal Marmoset WB, ELISA MO57305W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO45458FYA
SpecificityThis antibody binds to Rhesus INSIG2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. (From NCBI)
Product OverviewMouse Anti-Rhesus INSIG2 Antibody is a mouse antibody against INSIG2. It can be used for INSIG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInsulin-induced gene protein; INSIG2
UniProt IDF7HBW4
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIANLIRNEEGKTYLLYKKTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry