AibGenesis™ Mouse Anti-IQCF2 Antibody (MO-AB-03832W)


Cat: MO-AB-03832W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03832W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO03832W 100 µg
MO-AB-14253R Monoclonal Cattle (Bos taurus) WB, ELISA MO14253R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO03832W
SpecificityThis antibody binds to Rhesus IQCF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus IQCF2 Antibody is a mouse antibody against IQCF2. It can be used for IQCF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIQ Motif Containing F2
UniProt IDG7ML47
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MRVRFCTKGNLILIIIEDVEESIEWKTVQKKKQHKVKAKLRITKAAVKIQAWWRGTLVRRTLLHAALRAWIIQSWWRMTLSRVLEKKRQAALIAYATRERAVIKLQSLVRMWRVHWRYCQVLNAIYVIQGHWQCHNCQTCALLRGHCVVTATHLQFHIEIINS.
For Research Use Only | Not For Clinical Use.
Online Inquiry