AibGenesis™ Mouse Anti-ISOC2 Antibody (CBMOAB-45602FYA)


Cat: CBMOAB-45602FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45602FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45602FYA 100 µg
CBMOAB-81196FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81196FYA 100 µg
MO-AB-03850W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03850W 100 µg
MO-AB-10469W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10469W 100 µg
MO-AB-14305R Monoclonal Cattle (Bos taurus) WB, ELISA MO14305R 100 µg
MO-AB-26568H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26568C 100 µg
MO-AB-57387W Monoclonal Marmoset WB, ELISA MO57387W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45602FYA
SpecificityThis antibody binds to Rhesus ISOC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ISOC2 Antibody is a mouse antibody against ISOC2. It can be used for ISOC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesISOC2
UniProt IDF7DWN8
Protein RefseqThe length of the protein is 221 amino acids long.
The sequence is show below: MAAARPILGRVLPGSSILFLCDMQEKFRHNIAYFPQIVSVAARMLRVARLLEVPVLLTEQYPQGLGPTVPELGAEGLQPLTKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILDPCSYPGLALTSLYPQNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAAHPQFKEIQKLIKEPAPDSGLLGLFQGQNPLLH.
For Research Use Only | Not For Clinical Use.
Online Inquiry