AibGenesis™ Mouse Anti-ITPR3 Antibody (CBMOAB-45683FYA)


Cat: CBMOAB-45683FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45683FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO45683FYA 100 µg
CBMOAB-81353FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81353FYA 100 µg
MO-AB-14368R Monoclonal Cattle (Bos taurus) WB, ELISA MO14368R 100 µg
MO-AB-23541W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23541W 100 µg
MO-AB-26770R Monoclonal Pig (Sus scrofa) WB, ELISA MO26770R 100 µg
MO-AB-57466W Monoclonal Marmoset WB, ELISA MO57466W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO45683FYA
SpecificityThis antibody binds to Rhesus ITPR3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. The receptor contains a calcium channel at the C-terminus and the ligand-binding site at the N-terminus. Knockout studies in mice suggest that type 2 and type 3 inositol 1,4,5-trisphosphate receptors play a key role in exocrine secretion underlying energy metabolism and growth. (From NCBI)
Product OverviewMouse Anti-Rhesus ITPR3 Antibody is a mouse antibody against ITPR3. It can be used for ITPR3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInositol 1,4,5-trisphosphate receptor type 3; ITPR3
UniProt IDH9FIQ8
Protein RefseqThe length of the protein is 315 amino acids long.
The sequence is show below: QGVGHMMSTMVLSRKQSVFGAPSLPAGASAAEPLDRSKFEENEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVEAGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKGDAKMMEILRYTHQFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry