AibGenesis™ Mouse Anti-JAKMIP1 Antibody (CBMOAB-45719FYA)


Cat: CBMOAB-45719FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45719FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset WB, ELISA MO45719FYA 100 µg
MO-AB-03896W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03896W 100 µg
MO-AB-04583H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04583C 100 µg
MO-AB-14388R Monoclonal Cattle (Bos taurus) WB, ELISA MO14388R 100 µg
MO-AB-57491W Monoclonal Marmoset WB, ELISA MO57491W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset
CloneMO45719FYA
SpecificityThis antibody binds to Rhesus JAKMIP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus JAKMIP1 Antibody is a mouse antibody against JAKMIP1. It can be used for JAKMIP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesJAKMIP1
UniProt IDF7DKB0
Protein RefseqThe length of the protein is 262 amino acids long.
The sequence is show below: MNKKNEDLLQSIQRMEEKIKNLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDEESVDSETLSETSYNTDRTDRTPATPEEDLDDTTAREEADLRFCQLTRDTREQLQADLLRCQAKIEDLEKLLVEKGQDSKWVEEKQLLIRTNQDLLEKIYRLEMEENQLKNEMQDAKDQNELLEFRVLELEVRDSICCKLSNGADILFEPKLKFM.
For Research Use Only | Not For Clinical Use.
Online Inquiry