Mouse Anti-KCTD17 Antibody (CBMOAB-45980FYA)


Cat: CBMOAB-45980FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45980FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO45980FYA 100 µg
MO-AB-14496R Monoclonal Cattle (Bos taurus) WB, ELISA MO14496R 100 µg
MO-AB-26628H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26628C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO45980FYA
SpecificityThis antibody binds to Rhesus KCTD17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to a conserved family of potassium channel tetramerization domain (KCTD)-containing proteins. The encoded protein functions in ciliogenesis by acting as a substrate adaptor for the cullin3-based ubiquitin-conjugating enzyme E3 ligase, and targets trichoplein, a keratin-binding protein, for degradation via polyubiquitinylation. A mutation in this gene is associated with autosomal dominant myoclonic dystonia 26. (From NCBI)
Product OverviewMouse Anti-Rhesus KCTD17 Antibody is a mouse antibody against KCTD17. It can be used for KCTD17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKCTD17
UniProt IDF7HM03
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: MRMEAGEGAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSSPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEVEQVQVEADAQEKAQSSQDPANLFSLPPLPPPPLPAGGSRPHSLRPEAELAVRASPRPLARPQSCHPCCYKPEAPGCEAPDHLQGLGVPI.
For Research Use Only | Not For Clinical Use.
Online Inquiry