AibGenesis™ Mouse Anti-KLF14 Antibody (CBMOAB-46458FYA)


Cat: CBMOAB-46458FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46458FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO46458FYA 100 µg
MO-AB-26889R Monoclonal Pig (Sus scrofa) WB, ELISA MO26889R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO46458FYA
SpecificityThis antibody binds to Rhesus KLF14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KLF14 Antibody is a mouse antibody against KLF14. It can be used for KLF14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKLF14
UniProt IDF7FAS0
Protein RefseqThe length of the protein is 295 amino acids long.
The sequence is show below: MSAAVACLDYFAAECLVSMSAGAVVHHRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGPASVPPLPSGEGSWENSGEAPRASSGFSDPIPCSVQTPCSELAPASGAAAVCAPESSSGAPAVPSAPAAPGAPAASGGVSGGALGAGPAPVADQVPRRRPVTPAAKRHQCPFPGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRVDPPLASEVESSASGSGPGPAPSFTTCL.
For Research Use Only | Not For Clinical Use.
Online Inquiry