Mouse Anti-KPNA5 Antibody (CBMOAB-46586FYA)
Cat: CBMOAB-46586FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-46586FYA | Monoclonal | Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO46586FYA | 100 µg | ||
| CBMOAB-82228FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO82228FYA | 100 µg | ||
| MO-AB-02687Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02687Y | 100 µg | ||
| MO-AB-06602Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06602Y | 100 µg | ||
| MO-AB-08648Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08648Y | 100 µg | ||
| MO-AB-14626W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14626W | 100 µg | ||
| MO-AB-15932Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15932Y | 100 µg | ||
| MO-AB-35037W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35037W | 100 µg | ||
| MO-AB-57967W | Monoclonal | Marmoset | WB, ELISA | MO57967W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO46586FYA |
| Specificity | This antibody binds to Rhesus KPNA5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus KPNA5 Antibody is a mouse antibody against KPNA5. It can be used for KPNA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | KPNA5 |
| UniProt ID | F7GSA0 |
| Protein Refseq | The length of the protein is 171 amino acids long. The sequence is show below: LLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQRYSRANKFSILVTFF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry