AibGenesis™ Mouse Anti-KRT25 Antibody (CBMOAB-46631FYA)


Cat: CBMOAB-46631FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46631FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Sheep (Ovis aries) WB, ELISA MO46631FYA 100 µg
MO-AB-14721R Monoclonal Cattle (Bos taurus) WB, ELISA MO14721R 100 µg
MO-AB-15951Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15951Y 100 µg
MO-AB-24163W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24163W 100 µg
MO-AB-37573W Monoclonal Goat (Capra hircus) WB, ELISA MO37573W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Sheep (Ovis aries)
CloneMO46631FYA
SpecificityThis antibody binds to Rhesus KRT25.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. (From NCBI)
Product OverviewMouse Anti-Rhesus KRT25 Antibody is a mouse antibody against KRT25. It can be used for KRT25 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKRT25
UniProt IDF7BBR0
Protein RefseqThe length of the protein is 450 amino acids long.
The sequence is show below: MSLRLSSASRRSCPRPTTGSLRLSGGGTSFGAGNACGISGIGSSFSCALGGSSSGGNAAGGNPCAGFTVNEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELTEMKRTLQTLEIELQSLLATKRSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETEGQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDSAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry