AibGenesis™ Mouse Anti-KRT27 Antibody (CBMOAB-46632FYA)


Cat: CBMOAB-46632FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46632FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus) WB, ELISA MO46632FYA 100 µg
MO-AB-14723R Monoclonal Cattle (Bos taurus) WB, ELISA MO14723R 100 µg
MO-AB-37574W Monoclonal Goat (Capra hircus) WB, ELISA MO37574W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus)
CloneMO46632FYA
SpecificityThis antibody binds to Rhesus KRT27.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. (From NCBI)
Product OverviewMouse Anti-Rhesus KRT27 Antibody is a mouse antibody against KRT27. It can be used for KRT27 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKRT27
UniProt IDF7B5M7
Protein RefseqThe length of the protein is 459 amino acids long.
The sequence is show below: MSVRFSSTSRRLGSCGGAGSVRLSSGGAGFGAGNTCSVPGIGSGFSCAFGGSSSAGGYGGGLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENELALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSARNELTEMKRTLQTLEIELQSLLATKHSLEGSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETEGQKLEYEQLLDVKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTIVKTVVEEIDPRGKVLSSRVHTVEEKATKVNNKNEQRVPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry