AibGenesis™ Mouse Anti-KRT28 Antibody (CBMOAB-46633FYA)


Cat: CBMOAB-46633FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46633FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO46633FYA 100 µg
MO-AB-14724R Monoclonal Cattle (Bos taurus) WB, ELISA MO14724R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO46633FYA
SpecificityThis antibody binds to Rhesus KRT28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. (From NCBI)
Product OverviewMouse Anti-Rhesus KRT28 Antibody is a mouse antibody against KRT28. It can be used for KRT28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKRT28
UniProt IDF7B5I4
Protein RefseqThe length of the protein is 486 amino acids long.
The sequence is show below: MIFCSPGTLQFHTDKVNISQNTMSLRFSNGSRHVCLRSGAGSVRPSNGGAGFAGSSACGSSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKGWYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYENELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDAGAATSARSQLTELRRTLQTLEIQLQSLMATKHSLEGSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETEGQKLEYEQLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSSGNSSKDLSKTTLVKTVVEEIDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF.
For Research Use Only | Not For Clinical Use.
Online Inquiry