AibGenesis™ Mouse Anti-KRTAP24-1 Antibody (CBMOAB-46664FYA)


Cat: CBMOAB-46664FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46664FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO46664FYA 100 µg
MO-AB-15976Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15976Y 100 µg
MO-AB-26712H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26712C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO46664FYA
SpecificityThis antibody binds to Rhesus KRTAP24-1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus KRTAP24-1 Antibody is a mouse antibody against KRTAP24-1. It can be used for KRTAP24-1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKRTAP24-1
UniProt IDF6VLQ9
Protein RefseqThe length of the protein is 252 amino acids long.
The sequence is show below: MYTGSMSTLGYSGVCTSYRTHCYIPVTSSVTLSSNDLSPACGHYLPSSYQGNLWLLDYCQESYGEAPTCESPSCEPKTCSTTGCDPSNSSVPCNSPSAGQVFSVCETTNIKPSPSCSPCTQTNGYVCNCHTPTQSASKACQTLYNGSNCFGQLNCSSKSFQTPNHCRLSTLGYKSYQNPCFIPSYVSPLCYTSNSWQPQNYLMSNYHYTSYRPTSCRPLSYLSRSFRSLSCIPSTFPPLRYLCSGSRPLKCF.
For Research Use Only | Not For Clinical Use.
Online Inquiry