Mouse Anti-KRTCAP2 Antibody (CBMOAB-46666FYA)


Cat: CBMOAB-46666FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46666FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO46666FYA 100 µg
CBMOAB-82297FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82297FYA 100 µg
MO-AB-04765H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04765C 100 µg
MO-AB-14766R Monoclonal Cattle (Bos taurus) WB, ELISA MO14766R 100 µg
MO-AB-22633W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22633W 100 µg
MO-AB-26723H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26723C 100 µg
MO-AB-31551W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31551W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO46666FYA
SpecificityThis antibody binds to Rhesus KRTCAP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KRTCAP2 Antibody is a mouse antibody against KRTCAP2. It can be used for KRTCAP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKeratinocyte-associated protein 2; KRTCAP2
UniProt IDH9EYP6
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: MRIANRTGLSFPFLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry