AibGenesis™ Mouse Anti-LMOD2 Antibody (CBMOAB-47062FYA)


Cat: CBMOAB-47062FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-47062FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO47062FYA 100 µg
MO-AB-14997R Monoclonal Cattle (Bos taurus) WB, ELISA MO14997R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO47062FYA
SpecificityThis antibody binds to Rhesus LMOD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LMOD2 Antibody is a mouse antibody against LMOD2. It can be used for LMOD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLMOD2
UniProt IDF7BU89
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: QLLTSLPLAPLPASGCLECLVLQAPSGSDKAGTMSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESRCHHLLLLPLLHSQRKSSLRETLQKSSNNRRVPNGHYKMDKKKKGKKVKKQPNNVLKEIKNSLRSVQEKKMEDSSRPSTPQRSAHENLMEAIRGSSIKQLKRVEVPEALR.
For Research Use Only | Not For Clinical Use.
Online Inquiry