AibGenesis™ Mouse Anti-LPXN Antibody (MO-AB-04144W)


Cat: MO-AB-04144W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04144W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO04144W 100 µg
MO-AB-08722Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08722Y 100 µg
MO-AB-15034R Monoclonal Cattle (Bos taurus) WB, ELISA MO15034R 100 µg
MO-AB-15864W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15864W 100 µg
MO-AB-58308W Monoclonal Marmoset WB, ELISA MO58308W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO04144W
SpecificityThis antibody binds to Rhesus LPXN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin-induced tyrosine phosphorylation of paxillin (PXN). May play a critical role as an adapter protein in the formation of the adhesion zone in osteoclasts. Negatively regulates B-cell antigen receptor (BCR) signaling. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus LPXN Antibody is a mouse antibody against LPXN. It can be used for LPXN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeupaxin isoform 1; LPXN
UniProt IDH9F0M5
Protein RefseqThe length of the protein is 256 amino acids long.
The sequence is show below: MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKESNLDETSEILSVQDNTSPLPAQLVYTTNIQELNVYSEAQEPKVSPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCRKPIAGKVIHALGQAWHPEHFVCTHCKEEIGSSPFFERNGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry