AibGenesis™ Mouse Anti-LRRC20 Antibody (CBMOAB-49193FYA)


Cat: CBMOAB-49193FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49193FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO49193FYA 100 µg
CBMOAB-85433FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85433FYA 100 µg
MO-AB-15062R Monoclonal Cattle (Bos taurus) WB, ELISA MO15062R 100 µg
MO-AB-19896W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19896W 100 µg
MO-AB-26842H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26842C 100 µg
MO-AB-37630W Monoclonal Goat (Capra hircus) WB, ELISA MO37630W 100 µg
MO-AB-58356W Monoclonal Marmoset WB, ELISA MO58356W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO49193FYA
SpecificityThis antibody binds to Rhesus LRRC20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRC20 Antibody is a mouse antibody against LRRC20. It can be used for LRRC20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRC20
UniProt IDF6VI37
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: MLKKMGEAVARVARKVNETVESGSDTLELRLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPDGARAPLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry