AibGenesis™ Mouse Anti-LRRC37A2 Antibody (CBMOAB-49215FYA)


Cat: CBMOAB-49215FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49215FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO49215FYA 100 µg
MO-AB-24599W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24599W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO49215FYA
SpecificityThis antibody binds to Rhesus LRRC37A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRC37A2 Antibody is a mouse antibody against LRRC37A2. It can be used for LRRC37A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat-containing protein 37A3; LRRC37A2
UniProt IDH9FCU2
Protein RefseqThe length of the protein is 274 amino acids long.
The sequence is show below: FTILNFQGNYISYIDGNVWKAYSWTEKLILNENYLTELHKDSFEDLLSLQYLDLSCNKIQSIERRTFEPLPFLQFINLGCNLLTELSFGTFQAWHGMQFLHKLILNRNPLTTVEDPYLFKLPALKYLDMGKTQVPLTTLKNILTMTVELEKLILPSHMACCLCQFKNSIEAVCKTVKLHCNSACLTNTIRCSEELSVGNPEGAFMKVLQARWKHTSTELTIEPEVPSDRSGINFSGFGSEQLDTNDENEVISALSYILPYFSAGNLDAESILLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry