AibGenesis™ Mouse Anti-LYPD1 Antibody (MO-AB-04199W)


Cat: MO-AB-04199W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04199W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO04199W 100 µg
MO-AB-15180R Monoclonal Cattle (Bos taurus) WB, ELISA MO15180R 100 µg
MO-AB-26905H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26905C 100 µg
MO-AB-37635W Monoclonal Goat (Capra hircus) WB, ELISA MO37635W 100 µg
MO-AB-58481W Monoclonal Marmoset WB, ELISA MO58481W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus)
CloneMO04199W
SpecificityThis antibody binds to Rhesus LYPD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LYPD1 Antibody is a mouse antibody against LYPD1. It can be used for LYPD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLy6 / PLAUR domain-containing protein 1 isoform a; LYPD1
UniProt IDI2CT56
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLPTTILLLKLALFSAHC.
For Research Use Only | Not For Clinical Use.
Online Inquiry