Mouse Anti-LYPD5 Antibody (CBMOAB-49374FYA)


Cat: CBMOAB-49374FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49374FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO49374FYA 100 µg
MO-AB-04200W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04200W 100 µg
MO-AB-15183R Monoclonal Cattle (Bos taurus) WB, ELISA MO15183R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO49374FYA
SpecificityThis antibody binds to Rhesus LYPD5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LYPD5 Antibody is a mouse antibody against LYPD5. It can be used for LYPD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLYPD5
UniProt IDF7GFK4
Protein RefseqThe length of the protein is 250 amino acids long.
The sequence is show below: MAMGVPRVILLYLFAAALCLTGSQGLQCYSFEHTYFGPFDLRAMKLASISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNPDALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIGVHQDDCAISKSRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGTTSPWTAIDLQGSCCEGHLCNRKSMIQPFNSALATTPPRAVQVLALLLPVLLLVGLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry