Mouse Anti-LZIC Antibody (CBMOAB-49399FYA)


Cat: CBMOAB-49399FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49399FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO49399FYA 100 µg
CBMOAB-85673FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85673FYA 100 µg
MO-AB-13785W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13785W 100 µg
MO-AB-15220R Monoclonal Cattle (Bos taurus) WB, ELISA MO15220R 100 µg
MO-AB-26932H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26932C 100 µg
MO-AB-58501W Monoclonal Marmoset WB, ELISA MO58501W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO49399FYA
SpecificityThis antibody binds to Rhesus LZIC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for neuronal survival during early development. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus LZIC Antibody is a mouse antibody against LZIC. It can be used for LZIC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLZIC
UniProt IDF6YYT8
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKVPKKYEVFGIVSALEIIFLFYVSFFLGSGDKILALASFEVEKTKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry