AibGenesis™ Mouse Anti-Mamu-DPA Antibody (CBMOAB-50120FYA)


Cat: CBMOAB-50120FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-50120FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO50120FYA 100 µg
MO-AB-04240W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04240W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO50120FYA
SpecificityThis antibody binds to Rhesus Mamu-DPA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus Mamu-DPA Antibody is a mouse antibody against Mamu-DPA. It can be used for Mamu-DPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMHC class II antigen; Mamu-DPA
UniProt IDD7RD85
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MDINYRPHNVCPEDRMFQTRAIVLRTLSLAFLLSLRGAGAIKADHVSTYALFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNITIQRSNYTQAANDPPEVTVFPKEPVALGQPNTLICHIDKFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDYYDCRVEHWGLDQPLLKHWEAQEPIQIPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGRDPRAQGPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry