Mouse Anti-MAP6D1 Antibody (CBMOAB-50804FYA)


Cat: CBMOAB-50804FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-50804FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO50804FYA 100 µg
CBMOAB-85902FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85902FYA 100 µg
MO-AB-14426W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14426W 100 µg
MO-AB-15336R Monoclonal Cattle (Bos taurus) WB, ELISA MO15336R 100 µg
MO-AB-26965H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26965C 100 µg
MO-AB-58662W Monoclonal Marmoset WB, ELISA MO58662W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO50804FYA
SpecificityThis antibody binds to Rhesus MAP6D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein highly similar to the mouse MAP6 domain containing 1 protein, which is related to the STOP proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the Golgi membranes through N-terminal palmitoylation. (From NCBI)
Product OverviewMouse Anti-Rhesus MAP6D1 Antibody is a mouse antibody against MAP6D1. It can be used for MAP6D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMAP6 domain-containing protein 1; MAP6D1
UniProt IDH9FZZ6
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGPGGAASRRGQPAAGARDPGRDVPLTQYQRDFGLWTTHAGPKDQQPGRRPGAGGRRSKSSAQSSAPPAPGARGVYVLPIGDADATGAATTSYRQEFQAWTGVKPSRSTKAKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV.
For Research Use Only | Not For Clinical Use.
Online Inquiry